OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLC30A7 (NM_001144884) Human Mass Spec Standard

Be the first to review this product
SKU
PH327524
SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_001138356)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408825 Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SLC30A7 or NM_001144884"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227524
Predicted MW 41.4 kDa
Protein Sequence
Protein Sequence
>RC227524 representing NM_001144884
Red=Cloning site Green=Tags(s)

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH
MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER
LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH
GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV
SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW
ILSQTHNIFTQAGVRQLYVQIDFAAM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138356
RefSeq ORF 1128
Synonyms ZnT-7; ZNT7; ZnTL2
Locus ID 148867
UniProt ID Q8NEW0
Cytogenetics 1p21.2
Summary Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A7, permit cellular efflux of zinc (Seve et al., 2004 PubMed 15154973).supplied by OMIM, Mar 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLC30A7" proteins (7)
SKU Description Size Price
PH309198 SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_598003) 10 ug
$3,360.00
LC408825 Lyophilized SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428544 Lyophilized SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408825 Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428544 Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309198 Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1, 20 µg 20 ug
$867.00
TP327524 Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products