OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C17orf49 (NM_001142799) Human Mass Spec Standard

Be the first to review this product
SKU
PH326977
C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337767 Rabbit Polyclonal Anti-C17orf49 Antibody
100 ul
$585.00
LY406297 Transient overexpression lysate of chromosome 17 open reading frame 49 (C17orf49), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "C17orf49 or NM_001142799"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226977
Predicted MW 13.8 kDa
Protein Sequence
Protein Sequence
>RC226977 representing NM_001142799
Red=Cloning site Green=Tags(s)

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKV
ASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001136271
RefSeq ORF 414
Synonyms BAP18; HEPIS
Locus ID 124944
UniProt ID Q8IXM2
Cytogenetics 17p13.1
Summary Component of chromatin complexes such as the MLL1/MLL and NURF complexes.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C17orf49" proteins (6)
SKU Description Size Price
LC406297 Lyophilized C17orf49 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428281 Lyophilized C17orf49 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406297 Transient overexpression lysate of chromosome 17 open reading frame 49 (C17orf49), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428281 Transient overexpression lysate of chromosome 17 open reading frame 49 (C17orf49), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP326977 Recombinant protein of human chromosome 17 open reading frame 49 (C17orf49), transcript variant 3, 20 µg 20 ug
$867.00
TP761002 Purified recombinant protein of Human chromosome 17 open reading frame 49 (C17orf49), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products