OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNASEH2B (NM_001142279) Human Mass Spec Standard

Be the first to review this product
SKU
PH326833
RNASEH2B MS Standard C13 and N15-labeled recombinant protein (NP_001135751)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411236 Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RNASEH2B or NM_001142279"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226833
Predicted MW 28.8 kDa
Protein Sequence
Protein Sequence
>RC226833 representing NM_001142279
Red=Cloning site Green=Tags(s)

MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKH
HSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHH
VTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIR
YAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKMAAQRQKRGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135751
RefSeq ORF 771
Synonyms AGS2; DLEU8
Locus ID 79621
UniProt ID Q5TBB1
Cytogenetics 13q14.3
Summary RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). provided by RefSeq, Nov 2008
Protein Pathways DNA replication
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNASEH2B" proteins (5)
SKU Description Size Price
LC411236 Lyophilized RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428003 Lyophilized RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411236 Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428003 Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP326833 Recombinant protein of human ribonuclease H2, subunit B (RNASEH2B), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products