OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTHFD2 (MTHFD2L) (NM_001144978) Human Mass Spec Standard

Be the first to review this product
SKU
PH326798
MTHFD2L MS Standard C13 and N15-labeled recombinant protein (NP_001138450)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366110 MTHFD2L rabbit polyclonal antibody
100 ul
$310.00
LY428620 Transient overexpression lysate of methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like (MTHFD2L) (as WB positive control) 100 ug
$436.00

Other products for "MTHFD2 or NM_001144978"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226798
Predicted MW 37.1 kDa
Protein Sequence
Protein Sequence
>RC226798 representing NM_001144978
Red=Cloning site Green=Tags(s)

MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRG
VESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRV
SGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNV
VVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVK
EGAAVIDVGINYVHDPVTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138450
RefSeq ORF 1041
Locus ID 441024
UniProt ID Q9H903
Cytogenetics 4q13.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MTHFD2" proteins (3)
SKU Description Size Price
LC428620 Lyophilized MTHFD2L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY428620 Transient overexpression lysate of methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like (MTHFD2L) (as WB positive control) 100 ug
$436.00
TP326798 Recombinant protein of human methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like (MTHFD2L), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products