OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mortality Factor 4 like 2 (MORF4L2) (NM_001142421) Human Mass Spec Standard

Be the first to review this product
SKU
PH326678
MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135893)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY428080 Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Mortality Factor 4 like 2 or NM_001142421"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226678
Predicted MW 32.3 kDa
Protein Sequence
Protein Sequence
>RC226678 protein sequence
Red=Cloning site Green=Tags(s)

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG
SVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLV
TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEI
LLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS
AEYHRKAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135893
RefSeq Size 1929
RefSeq ORF 864
Synonyms MORFL2; MRGX
Locus ID 9643
UniProt ID Q15014
Cytogenetics Xq22.2
Summary Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Mortality Factor 4 like 2" proteins (14)
SKU Description Size Price
PH310566 MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_036418) 10 ug
$3,360.00
PH326523 MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135890) 10 ug
$3,360.00
PH326563 MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135891) 10 ug
$3,360.00
PH326622 MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135892) 10 ug
$3,360.00
LC402188 Lyophilized MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428080 Lyophilized MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402188 Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428080 Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310566 Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 2, 20 µg 20 ug
$867.00
TP326523 Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 1, 20 µg 20 ug
$867.00
TP326563 Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 3, 20 µg 20 ug
$867.00
TP326622 Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 4, 20 µg 20 ug
$867.00
TP326678 Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 5, 20 µg 20 ug
$867.00
TP720543 Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products