OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MBD3L5 (NM_001136507) Human Mass Spec Standard

Be the first to review this product
SKU
PH326640
MBD3L5 MS Standard C13 and N15-labeled recombinant protein (NP_001129979)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY427904 Transient overexpression lysate of methyl-CpG-binding domain protein 3-like 5-like (MBD3L5) (as WB positive control) 100 ug
$436.00

Other products for "MBD3L5 or NM_001136507"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226640
Predicted MW 22.8 kDa
Protein Sequence
Protein Sequence
>RC226640 representing NM_001136507
Red=Cloning site Green=Tags(s)

MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDN
QVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLE
PTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARQAEMLTGG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129979
RefSeq ORF 624
Locus ID 284428
UniProt ID A6NJ08
Cytogenetics 19p13.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MBD3L5" proteins (3)
SKU Description Size Price
LC427904 Lyophilized MBD3L5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY427904 Transient overexpression lysate of methyl-CpG-binding domain protein 3-like 5-like (MBD3L5) (as WB positive control) 100 ug
$436.00
TP326640 Recombinant protein of human methyl-CpG-binding domain protein 3-like 5-like (MBD3L5), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products