OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TXNL4B (NM_001142318) Human Mass Spec Standard

Be the first to review this product
SKU
PH326616
TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_001135790)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413417 Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TXNL4B or NM_001142318"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226616
Predicted MW 17 kDa
Protein Sequence
Protein Sequence
>RC226616 protein sequence
Red=Cloning site Green=Tags(s)

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYT
QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP
KYDLLYQDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135790
RefSeq Size 2412
RefSeq ORF 447
Synonyms Dim2; DLP
Locus ID 54957
UniProt ID Q9NX01
Cytogenetics 16q22.2
Summary Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TXNL4B" proteins (10)
SKU Description Size Price
PH301503 TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_060323) 10 ug
$3,360.00
LC413417 Lyophilized TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428035 Lyophilized TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428036 Lyophilized TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413417 Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428035 Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428036 Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301503 Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 1, 20 µg 20 ug
$867.00
TP326616 Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 3, 20 µg 20 ug
$867.00
TP761241 Purified recombinant protein of Human thioredoxin-like 4B (TXNL4B), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products