OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAFD1 (NM_001143906) Human Mass Spec Standard

Be the first to review this product
SKU
PH326568
TRAFD1 MS Standard C13 and N15-labeled recombinant protein (NP_001137378)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809366 TRAFD1 mouse monoclonal antibody,clone OTI3E8 100 ul
$447.00
LY402005 Transient overexpression lysate of TRAF-type zinc finger domain containing 1 (TRAFD1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "TRAFD1 or NM_001143906"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226568
Predicted MW 64.8 kDa
Protein Sequence
Protein Sequence
>RC226568 protein sequence
Red=Cloning site Green=Tags(s)

MAEFLDDQETRLCDNCKKEIPVFNFTIHEIHCQRNIGMCPTCKEPFPKSDMETHMAAEHCQVTCKCNKKL
EKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGE
EKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSI
QNNLFEEQERQERNRGQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLS
DIKGAADEIMLPCEFCEELYPEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPDVIFQNFLQQAASNQL
DSLMGLSNSHPVEESIIIPCEFCGVQLEEEVLFHHQDQCDQRPATATNHVTEGIPRLDSQPQETSPELPR
RRVRHQGDLSSGYLDDTKQETANGPTSCLPPSRPINNMTATYNQLSRSTSGPRPGCQPSSPCVPKLSNSD
SQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENIVPSFSPGPSGRYGASGRSEGGRNSRVTPAAANYRS
RTAKAKPSKQQGAGDAEEEEEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001137378
RefSeq Size 3196
RefSeq ORF 1746
Synonyms FLN29
Locus ID 10906
UniProt ID O14545
Cytogenetics 12q24.13
Summary The innate immune system confers host defense against viral and microbial infection, and TRAFD1 is a negative feedback regulator that controls excessive immune responses (Sanada et al., 2008 PubMed 18849341).supplied by OMIM, Dec 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRAFD1" proteins (5)
SKU Description Size Price
LC402005 Lyophilized TRAFD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428399 Lyophilized TRAFD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402005 Transient overexpression lysate of TRAF-type zinc finger domain containing 1 (TRAFD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428399 Transient overexpression lysate of TRAF-type zinc finger domain containing 1 (TRAFD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP326568 Recombinant protein of human TRAF-type zinc finger domain containing 1 (TRAFD1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products