OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEC14L1 (NM_001143999) Human Mass Spec Standard

Be the first to review this product
SKU
PH326540
SEC14L1 MS Standard C13 and N15-labeled recombinant protein (NP_001137471)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808987 SEC14L1 mouse monoclonal antibody,clone OTI3A6 100 ul
$447.00
LY418958 Transient overexpression lysate of SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "SEC14L1 or NM_001143999"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226540
Predicted MW 81.2 kDa
Protein Sequence
Protein Sequence
>RC226540 protein sequence
Red=Cloning site Green=Tags(s)

MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLK
KIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPENEDWTCFEQSASLDIKSFFGF
ESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSSKKQAASMAVVIPE
AALKEGLSGDALSSPSAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHI
LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMD
TKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE
CMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQIVDASSVITWDFDVCKGDI
VFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQGSHVTRWPG
FYILQWKFHSMPACAASSLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAA
TTSSSQSHSSSMISR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001137471
RefSeq Size 5542
RefSeq ORF 2145
Synonyms PRELID4A; SEC14L
Locus ID 6397
UniProt ID Q92503
Cytogenetics 17q25.2-q25.3
Summary The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene; some variants represent read-through transcripts that include exons from the upstream gene C17orf86. provided by RefSeq, Feb 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEC14L1" proteins (11)
SKU Description Size Price
PH311801 SEC14L1 MS Standard C13 and N15-labeled recombinant protein (NP_002994) 10 ug
$3,360.00
PH326531 SEC14L1 MS Standard C13 and N15-labeled recombinant protein (NP_001137470) 10 ug
$3,360.00
LC418958 Lyophilized SEC14L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428458 Lyophilized SEC14L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428459 Lyophilized SEC14L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418958 Transient overexpression lysate of SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY428458 Transient overexpression lysate of SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY428459 Transient overexpression lysate of SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 4 (as WB positive control) 100 ug
$665.00
TP311801 Recombinant protein of human SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 1, 20 µg 20 ug
$867.00
TP326531 Recombinant protein of human SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 3, 20 µg 20 ug
$867.00
TP326540 Recombinant protein of human SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products