OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GBP5 (NM_001134486) Human Mass Spec Standard

Be the first to review this product
SKU
PH325986
GBP5 MS Standard C13 and N15-labeled recombinant protein (NP_001127958)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502242 GBP5 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9) 100 ul
$447.00
LY409377 Transient overexpression lysate of guanylate binding protein 5 (GBP5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GBP5 or NM_001134486"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225986
Predicted MW 66.6 kDa
Protein Sequence
Protein Sequence
>RC225986 protein sequence
Red=Cloning site Green=Tags(s)

MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSVAST
VQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALALLLSSTFVYNTVNKIDQGAID
LLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDGQLVTPDEYLENSLRPKQGS
DQRVQNFNLPRLCIQKFFPKKKCFIFDLPAHQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTL
PGGIMVNGSRLKNLVLTYVNAISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQE
LLDLHRTSEREAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV
KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQALTETEKKKKEA
QVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQ
AQNRSLLSELQHAQRTVNNDDPCVLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001127958
RefSeq Size 3957
RefSeq ORF 1758
Synonyms GBP-5
Locus ID 115362
UniProt ID Q96PP8
Cytogenetics 1p22.2
Summary This gene belongs to the TRAFAC class dynamin-like GTPase superfamily. The encoded protein acts as an activator of NLRP3 inflammasome assembly and has a role in innate immunity and inflammation. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GBP5" proteins (7)
SKU Description Size Price
PH306627 GBP5 MS Standard C13 and N15-labeled recombinant protein (NP_443174) 10 ug
$3,360.00
LC409377 Lyophilized GBP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427458 Lyophilized GBP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409377 Transient overexpression lysate of guanylate binding protein 5 (GBP5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427458 Transient overexpression lysate of guanylate binding protein 5 (GBP5), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306627 Recombinant protein of human guanylate binding protein 5 (GBP5), transcript variant 1, 20 µg 20 ug
$867.00
TP325986 Recombinant protein of human guanylate binding protein 5 (GBP5), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products