OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC2 (NM_001129887) Human Mass Spec Standard

Be the first to review this product
SKU
PH325965
DNAJC2 MS Standard C13 and N15-labeled recombinant protein (NP_001123359)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368035 DNAJC2 rabbit polyclonal antibody
100 ul
$310.00
LY415322 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 2 (DNAJC2), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "DNAJC2 or NM_001129887"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225965
Predicted MW 65.7 kDa
Protein Sequence
Protein Sequence
>RC225965 representing NM_001129887
Red=Cloning site Green=Tags(s)

MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQL
EEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTC
ITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFED
VDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRI
KKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIK
KERQKLRNSCKIEEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGT
NSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATPSER
FEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQV
LNASRAKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001123359
RefSeq ORF 1704
Synonyms MPHOSPH11; MPP11; ZRF1; ZUO1
Locus ID 27000
UniProt ID Q99543
Cytogenetics 7q22.1
Summary This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC2" proteins (5)
SKU Description Size Price
LC415322 Lyophilized DNAJC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427071 Lyophilized DNAJC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415322 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 2 (DNAJC2), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY427071 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 2 (DNAJC2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP325965 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 2 (DNAJC2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products