OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CRPPA (NM_001101417) Human Mass Spec Standard

Be the first to review this product
SKU
PH325626
ISPD MS Standard C13 and N15-labeled recombinant protein (NP_001094887)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344255 Rabbit Polyclonal Anti-hCG_1745121 Antibody - N-terminal region
100 ul
$585.00
LY426159 Transient overexpression lysate of isoprenoid synthase domain containing (ISPD), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CRPPA or NM_001101417"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225626
Predicted MW 44.2 kDa
Protein Sequence
Protein Sequence
>RC225626 representing NM_001101417
Red=Cloning site Green=Tags(s)

MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAVLPAGGCGERMGVPTPKQFCP
ILERPLISYTLQALERVCWIKDIVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAED
QINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHGCSDYDLEFGTECLQLALKYCCTKAKLVEGSPD
LWKVTYKRDLYAAESIIKERISQEICVVMDTEEDNKHVGHLLEEVLKSELNHVKVTSEALGHAGRHLQQI
ILDQCYNFVCVNVTTSDFQETQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQIREFAKE
VKERNILLYGLLISYPQDDQKLQESLRQGAIIIASLIKERNSGLIGQLLIA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001094887
RefSeq ORF 1203
Synonyms hISPD; ISPD; LGMDR20; MDDGA7; MDDGC7; Nip
Locus ID 729920
UniProt ID A4D126
Cytogenetics 7p21.2
Summary This gene encodes a 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein. Mutations in this gene are the cause of Walker-Warburg syndrome. Alternate splicing results in multiple transcript variants. provided by RefSeq, May 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CRPPA" proteins (7)
SKU Description Size Price
PH325744 ISPD MS Standard C13 and N15-labeled recombinant protein (NP_001094896) 10 ug
$3,360.00
LC426159 Lyophilized ISPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426161 Lyophilized ISPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY426159 Transient overexpression lysate of isoprenoid synthase domain containing (ISPD), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426161 Transient overexpression lysate of isoprenoid synthase domain containing (ISPD), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP325626 Recombinant protein of human notch1-induced protein (LOC729920), transcript variant 2, 20 µg 20 ug
$737.00
TP325744 Recombinant protein of human notch1-induced protein (LOC729920), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products