OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SIRPB2 (NM_001122962) Human Mass Spec Standard

Be the first to review this product
SKU
PH325507
SIRPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001116434)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334081 Rabbit Polyclonal Anti-SIRPB2 Antibody
100 ul
$585.00
LY426589 Transient overexpression lysate of signal-regulatory protein beta 2 (SIRPB2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SIRPB2 or NM_001122962"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225507
Predicted MW 36.8 kDa
Protein Sequence
Protein Sequence
>RC225507 representing NM_001122962
Red=Cloning site Green=Tags(s)

MCSTMSAPTCLAHLPPCFLLLALVLVPSDASGQSSRNDWQVLQPEGPMLVAEGETLLLRCMVVGSCTDGM
IKWVKVSTQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMK
SDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTVLGDGPPGPIRWFQGAGLSREAIYNFGGI
SHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPA
TEMSPTGLLVVFAPVVLGLKAITLAALLLALATSRRSPGQEDVKTTGPAGAMNTLAWSKGQE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001116434
RefSeq ORF 1026
Synonyms dJ776F14.2; PTPN1L; PTPNS1L3
Locus ID 284759
UniProt ID Q5JXA9
Cytogenetics 20p13
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SIRPB2" proteins (3)
SKU Description Size Price
LC426589 Lyophilized SIRPB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY426589 Transient overexpression lysate of signal-regulatory protein beta 2 (SIRPB2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP325507 Recombinant protein of human signal-regulatory protein beta 2 (SIRPB2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products