OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FRG2C (NM_001124759) Human Mass Spec Standard

Be the first to review this product
SKU
PH325388
FRG2C MS Standard C13 and N15-labeled recombinant protein (NP_001118231)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY426628 Transient overexpression lysate of FSHD region gene 2 family, member C (FRG2C) (as WB positive control) 100 ug
$436.00

Other products for "FRG2C or NM_001124759"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225388
Predicted MW 30.6 kDa
Protein Sequence
Protein Sequence
>RC225388 representing NM_001124759
Red=Cloning site Green=Tags(s)

MGKGNEDPDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKGKGKTAFSHSSEKHTQRQAGSDPNPNKEN
SEETKLKAGNSTAGSEPESSSYQENCRKRKISSKDICQDRAGNCPEEECNLTLNKKSRSSTAVHNSEIQE
TCDAHHRGSSRACTGRSKRHRSRALEVQTPSLRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTL
LTRLRGPLCAQVQTLYSMATQAAYVFPAESWLVPATLPGPGDSALDREAHPFPGQEITEPVSGSDEAKLG
AP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001118231
RefSeq ORF 846
Locus ID 100288801
UniProt ID A6NGY1
Cytogenetics 3p12.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FRG2C" proteins (3)
SKU Description Size Price
LC426628 Lyophilized FRG2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY426628 Transient overexpression lysate of FSHD region gene 2 family, member C (FRG2C) (as WB positive control) 100 ug
$436.00
TP325388 Recombinant protein of human FSHD region gene 2 family, member C (FRG2C), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products