OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KHDC1L (NM_001126063) Human Mass Spec Standard

Be the first to review this product
SKU
PH325082
KHDC1L MS Standard C13 and N15-labeled recombinant protein (NP_001119535)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY426643 Transient overexpression lysate of KH homology domain containing 1-like (KHDC1L) (as WB positive control) 100 ug
$436.00

Other products for "KHDC1L or NM_001126063"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225082
Predicted MW 14.4 kDa
Protein Sequence
Protein Sequence
>RC225082 representing NM_001126063
Red=Cloning site Green=Tags(s)

MAVGTSALSKEPWWTLPENFHSPMVFHMEEDQEELIFGLDDTYLRCIELHSHTLIQLERCFTATGQTRVT
VVGPPMAKQWLLLMFHCVGSQDSKCHARGLKMLERVRSQPLTNDDLVTSVSLPPYTGD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001119535
RefSeq ORF 384
Locus ID 100129128
UniProt ID Q5JSQ8
Cytogenetics 6q13
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KHDC1L" proteins (3)
SKU Description Size Price
LC426643 Lyophilized KHDC1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY426643 Transient overexpression lysate of KH homology domain containing 1-like (KHDC1L) (as WB positive control) 100 ug
$436.00
TP325082 Recombinant protein of human hypothetical protein LOC100129128 (LOC100129128), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products