OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CEACAM16 (NM_001039213) Human Mass Spec Standard

Be the first to review this product
SKU
PH324965
CEACAM16 MS Standard C13 and N15-labeled recombinant protein (NP_001034302)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336002 Rabbit Polyclonal Anti-CEACAM16 Antibody
100 ul
$585.00
LY422030 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 16 (CEACAM16) (as WB positive control) 100 ug
$665.00

Other products for "CEACAM16 or NM_001039213"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224965
Predicted MW 52.68 kDa
Protein Sequence
Protein Sequence
>RC224965 representing NM_001039213
Red=Cloning site Green=Tags(s)

MSDLLSIYSAPVVVSTVLHMLQIRKLRLGRVHKLPRVLEVGNSGTMSRAYTFFFLRWSFMALTGYSWLLL
SATFLNVGAEISITLEPAQPSEGDNVTLVVHGLSGELLAYSWYAGPTLSVSYLVASYIVSTGDETPGPAH
TGREAVRPDGSLDIQGILPRHSGTYILQTFNRQLQTEVGYGHVQVHEILAQPTVLANSTALVERRDTLRL
MCSSPSPTAEVRWFFNGGALPVALRLGLSPDGRVLARHGIRREEAGAYQCEVWNPVSVSRSEPINLTVYF
GPERVAILQDSTTRTGCTIKVDFNTSLTLWCVSRSCPEPEYVWTFNGQALKNGQDHLNISSMTAAQEGTY
TCIAKNTKTLLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRL
LSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034302
RefSeq Size 1797
RefSeq ORF 1452
Synonyms CEAL2; DFNA4B; DFNB113
Locus ID 388551
UniProt ID Q2WEN9
Cytogenetics 19q13.31-q13.32
Summary The protein encoded by this gene is a secreted glycoprotein that in mouse interacts with tectorial membrane proteins in the inner ear. The encoded adhesion protein is found in cochlear outer hair cells and appears to be important for proper hearing over an extended frequency range. Defects in this gene likely are a cause of non-syndromic autosomal dominant hearing loss. provided by RefSeq, May 2012
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CEACAM16" proteins (3)
SKU Description Size Price
LC422030 Lyophilized CEACAM16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422030 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 16 (CEACAM16) (as WB positive control) 100 ug
$665.00
TP324965 Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 16 (CEACAM16), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products