OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ICEBERG (CARD18) (NM_021571) Human Mass Spec Standard

Be the first to review this product
SKU
PH324896
CARD18 MS Standard C13 and N15-labeled recombinant protein (NP_067546)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359321 CARD18 Antibody - middle region
100 ul
$585.00
LY411985 Transient overexpression lysate of caspase recruitment domain family, member 18 (CARD18) (as WB positive control) 100 ug
$436.00

Other products for "ICEBERG or NM_021571"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224896
Predicted MW 10 kDa
Protein Sequence
Protein Sequence
>RC224896 representing NM_021571
Red=Cloning site Green=Tags(s)

MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCC
KFIKHLCEEDPQLASKMGLH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067546
RefSeq Size 431
RefSeq ORF 270
Synonyms ICEBERG; pseudo-ICE; UNQ5804
Locus ID 59082
UniProt ID P57730
Cytogenetics 11q22.3
Summary Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ICEBERG" proteins (3)
SKU Description Size Price
LC411985 Lyophilized CARD18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411985 Transient overexpression lysate of caspase recruitment domain family, member 18 (CARD18) (as WB positive control) 100 ug
$436.00
TP324896 Recombinant protein of human caspase recruitment domain family, member 18 (CARD18), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products