OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM80 (NM_001042463) Human Mass Spec Standard

Be the first to review this product
SKU
PH324685
TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_001035928)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501452 TMEM80 mouse monoclonal antibody, clone OTI2B7 (formerly 2B7) 100 ul
$447.00
LY406341 Transient overexpression lysate of transmembrane protein 80 (TMEM80), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TMEM80 or NM_001042463"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224685
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC224685 representing NM_001042463
Red=Cloning site Green=Tags(s)

MAEGARARGPRGCRDRDGPAGGAGKMAAPRRGRGSSTVLSSVPLQMLFYLSGTYYALYFLATLLMITYKS
QVFSYPHRYLVLDLALLFLMGILEAVRLYLGTRGNLTEAERPLAASLALTAGTALLSAHFLLWQALVLWA
DWALSATLLALHGLEAVLQVVAIAAFTR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035928
RefSeq Size 1637
RefSeq ORF 504
Locus ID 283232
UniProt ID Q96HE8
Cytogenetics 11p15.5
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM80" proteins (5)
SKU Description Size Price
PH302288 TMEM80 MS Standard C13 and N15-labeled recombinant protein (NP_777600) 10 ug
$3,360.00
LC406341 Lyophilized TMEM80 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406341 Transient overexpression lysate of transmembrane protein 80 (TMEM80), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302288 Recombinant protein of human transmembrane protein 80 (TMEM80), transcript variant 1, 20 µg 20 ug
$867.00
TP324685 Purified recombinant protein of Homo sapiens transmembrane protein 80 (TMEM80), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products