OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPR141 (NM_181791) Human Mass Spec Standard

Be the first to review this product
SKU
PH324590
GPR141 MS Standard C13 and N15-labeled recombinant protein (NP_861456)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331550 Rabbit Polyclonal Anti-GPR141 Antibody
100 ul
$585.00
LY403629 Transient overexpression lysate of G protein-coupled receptor 141 (GPR141) (as WB positive control) 100 ug
$436.00

Other products for "GPR141 or NM_181791"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224590
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC224590 representing NM_181791
Red=Cloning site Green=Tags(s)

MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVP
FRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMW
TLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQK
LRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDL
LLFVFGGSHWFKQKIIGLWNCVLCR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_861456
RefSeq Size 918
RefSeq ORF 915
Synonyms PGR13
Locus ID 353345
UniProt ID Q7Z602
Cytogenetics 7p14.1
Summary GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 PubMed 14623098).supplied by OMIM, Mar 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GPR141" proteins (3)
SKU Description Size Price
LC403629 Lyophilized GPR141 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403629 Transient overexpression lysate of G protein-coupled receptor 141 (GPR141) (as WB positive control) 100 ug
$436.00
TP324590 Recombinant protein of human G protein-coupled receptor 141 (GPR141), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products