OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C1orf53 (NM_001024594) Human Mass Spec Standard

Be the first to review this product
SKU
PH324510
C1orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001019765)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422513 Transient overexpression lysate of chromosome 1 open reading frame 53 (C1orf53) (as WB positive control) 100 ug
$436.00

Other products for "C1orf53 or NM_001024594"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224510
Predicted MW 15.5 kDa
Protein Sequence
Protein Sequence
>RC224510 protein sequence
Red=Cloning site Green=Tags(s)

MAARQIWARTGAALCRQPSAAPPPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVSE
ELTAAERQIAELHAAACAAGQLNYVDPATGYVVLTQIAHLQRGECCGSACRHCPYGQVNVKDPSKKKQFN
SYFYV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001019765
RefSeq Size 697
RefSeq ORF 435
Locus ID 388722
UniProt ID Q5VUE5
Cytogenetics 1q31.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C1orf53" proteins (3)
SKU Description Size Price
LC422513 Lyophilized C1orf53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422513 Transient overexpression lysate of chromosome 1 open reading frame 53 (C1orf53) (as WB positive control) 100 ug
$436.00
TP324510 Recombinant protein of human chromosome 1 open reading frame 53 (C1orf53), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products