OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARF1 (NM_001024226) Human Mass Spec Standard

Be the first to review this product
SKU
PH324474
ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019397)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346559 Rabbit Polyclonal Anti-ARF1 Antibody
100 ul
$585.00
LY419819 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "ARF1 or NM_001024226"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224474
Predicted MW 20.7 kDa
Protein Sequence
Protein Sequence
>RC224474 protein sequence
Red=Cloning site Green=Tags(s)

MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001019397
RefSeq Size 1986
RefSeq ORF 543
Synonyms PVNH8
Locus ID 375
UniProt ID P84077
Cytogenetics 1q42.13
Summary ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Pathways Vibrio cholerae infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARF1" proteins (13)
SKU Description Size Price
PH301240 ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019398) 10 ug
$3,360.00
PH302141 ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001649) 10 ug
$3,360.00
LC419819 Lyophilized ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422625 Lyophilized ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422626 Lyophilized ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422627 Lyophilized ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419819 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY422625 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422626 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422627 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301240 Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 20 µg 20 ug
$867.00
TP302141 Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 4, 20 µg 20 ug
$867.00
TP324474 Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products