ARF1 (NM_001024226) Human Mass Spec Standard

SKU
PH324474
ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019397)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224474]
Predicted MW 20.7 kDa
Protein Sequence
Protein Sequence
>RC224474 protein sequence
Red=Cloning site Green=Tags(s)

MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001019397
RefSeq Size 1986
RefSeq ORF 543
Synonyms PVNH8
Locus ID 375
UniProt ID P84077
Cytogenetics 1q42.13
Summary ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Vibrio cholerae infection
Write Your Own Review
You're reviewing:ARF1 (NM_001024226) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301240 ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019398) 10 ug
$3,255.00
PH302141 ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001649) 10 ug
$3,255.00
LC419819 ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422625 ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422626 ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422627 ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425449 ARF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419819 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 4 100 ug
$436.00
LY422625 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 3 100 ug
$436.00
LY422626 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 1 100 ug
$436.00
LY422627 Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 2 100 ug
$436.00
TP301240 Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP302141 Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324474 Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.