OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PFTK1 (CDK14) (NM_012395) Human Mass Spec Standard

Be the first to review this product
SKU
PH324426
CDK14 MS Standard C13 and N15-labeled recombinant protein (NP_036527)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415792 Transient overexpression lysate of cyclin-dependent kinase 14 (CDK14) (as WB positive control) 100 ug
$665.00

Other products for "PFTK1 or NM_012395"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224426
Predicted MW 50.5 kDa
Protein Sequence
Protein Sequence
>RC224426 representing NM_012395
Red=Cloning site Green=Tags(s)

MHGYFGCNAAAEPGYSAFVGTPQICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPAN
QVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
KLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGL
HPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYR
PPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKP
ERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTV
PNVRLQPEAGESMRAFGKNNSYGKSLSNSKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036527
RefSeq Size 4953
RefSeq ORF 1353
Synonyms PFTAIRE1; PFTK1
Locus ID 5218
UniProt ID O94921
Cytogenetics 7q21.13
Summary PFTK1 is a member of the CDC2 (MIM 116940)-related protein kinase family (Yang and Chen, 2001 PubMed 11313143).supplied by OMIM, Mar 2008
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PFTK1" proteins (3)
SKU Description Size Price
LC415792 Lyophilized CDK14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415792 Transient overexpression lysate of cyclin-dependent kinase 14 (CDK14) (as WB positive control) 100 ug
$665.00
TP324426 Recombinant protein of human PFTAIRE protein kinase 1 (PFTK1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products