OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AMPD3 (NM_001025390) Human Mass Spec Standard

Be the first to review this product
SKU
PH324327
AMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_001020561)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358769 AMPD3 Antibody - C-terminal region
100 ul
$585.00
LY422441 Transient overexpression lysate of adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 3 (as WB positive control) 100 ug
$665.00

Other products for "AMPD3 or NM_001025390"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224327
Predicted MW 89.3 kDa
Protein Sequence
Protein Sequence
>RC224327 representing NM_001025390
Red=Cloning site Green=Tags(s)

MEPGSAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKEL
AEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPEFQRV
TISGDYCAGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQYLGHPRADTAPPEEGLPDFHPPPL
PQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTY
CHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDR
TVAEKRGRKITLRQVFDGLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLG
GEYFARMVKEVARELEESKYQYSEPRLSIYGRSPEEWPNLAYWFIQHKVYSPNMRWIIQVPRIYDIFRSK
KLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPNPDVWTSEQNP
PYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYY
LAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDL
CEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEIT
ALTN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020561
RefSeq Size 4473
RefSeq ORF 2322
Locus ID 272
UniProt ID Q01432
Cytogenetics 11p15.4
Summary This gene encodes a member of the AMP deaminase gene family. The encoded protein is a highly regulated enzyme that catalyzes the hydrolytic deamination of adenosine monophosphate to inosine monophosphate, a branch point in the adenylate catabolic pathway. This gene encodes the erythrocyte (E) isoforms, whereas other family members encode isoforms that predominate in muscle (M) and liver (L) cells. Mutations in this gene lead to the clinically asymptomatic, autosomal recessive condition erythrocyte AMP deaminase deficiency. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AMPD3" proteins (7)
SKU Description Size Price
PH312077 AMPD3 MS Standard C13 and N15-labeled recombinant protein (NP_000471) 10 ug
$3,360.00
LC422441 Lyophilized AMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424690 Lyophilized AMPD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422441 Transient overexpression lysate of adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY424690 Transient overexpression lysate of adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP312077 Recombinant protein of human adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 1, 20 µg 20 ug
$867.00
TP324327 Recombinant protein of human adenosine monophosphate deaminase (isoform E) (AMPD3), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products