OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BEND6 (NM_152731) Human Mass Spec Standard

Be the first to review this product
SKU
PH324260
BEND6 MS Standard C13 and N15-labeled recombinant protein (NP_689944)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407329 Transient overexpression lysate of BEN domain containing 6 (BEND6) (as WB positive control) 100 ug
$436.00

Other products for "BEND6 or NM_152731"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224260
Predicted MW 31 kDa
Protein Sequence
Protein Sequence
>RC224260 representing NM_152731
Red=Cloning site Green=Tags(s)

MQKIVQTDEITNTQAFRKGKRKRTETMDSENANSDMDKGQRDPYSGNAFLPGESSSEDEEPLAELSKEEL
CAKIKSLKEKLTNTRKENSRLRQSLVMLQVLPQAVTQFEELVGMAEALLKGGGTMSTSASTLWRATNNSS
PDSFASTCSNSNSNSSSPVSLKPEEEHQTDEKQFQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHS
LTGAKSSTSRDKAVKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTKKPNLSKNLNSQDIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689944
RefSeq Size 2727
RefSeq ORF 837
Synonyms C6orf65
Locus ID 221336
UniProt ID Q5SZJ8
Cytogenetics 6p12.1
Summary Acts as a corepressor of recombining binding protein suppressor hairless (RBPJ) and inhibits Notch signaling in neural stem cells, thereby opposing their self-renewal and promoting neurogenesis (PubMed:23571214).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BEND6" proteins (3)
SKU Description Size Price
LC407329 Lyophilized BEND6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407329 Transient overexpression lysate of BEN domain containing 6 (BEND6) (as WB positive control) 100 ug
$436.00
TP324260 Recombinant protein of human BEN domain containing 6 (BEND6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products