OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ACOT7 (NM_181866) Human Mass Spec Standard

Be the first to review this product
SKU
PH324159
ACOT7 MS Standard C13 and N15-labeled recombinant protein (NP_863656)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358148 ACOT7 Antibody - C-terminal region
100 ul
$585.00
LY405559 Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHb (as WB positive control) 100 ug
$436.00

Other products for "ACOT7 or NM_181866"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224159
Predicted MW 36.4 kDa
Protein Sequence
Protein Sequence
>RC224159 representing NM_181866
Red=Cloning site Green=Tags(s)

MAFQLSRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEV
AHVSAEITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGR
KRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIV
AARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFFT
YVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHAEPQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_863656
RefSeq Size 1376
RefSeq ORF 987
Synonyms ACH1; ACT; BACH; CTE-II; hBACH; LACH; LACH1
Locus ID 11332
UniProt ID O00154
Cytogenetics 1p36.31
Summary This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternatively spliced transcript variants encoding distinct isoforms with different subcellular locations have been characterized. provided by RefSeq, Jul 2008
Protein Pathways Biosynthesis of unsaturated fatty acids
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ACOT7" proteins (7)
SKU Description Size Price
LC405559 Lyophilized ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405560 Lyophilized ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405561 Lyophilized ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405559 Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHb (as WB positive control) 100 ug
$436.00
LY405560 Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHc (as WB positive control) 100 ug
$436.00
LY405561 Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHd (as WB positive control) 100 ug
$436.00
TP324159 Recombinant protein of human acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHd, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products