PGRP1B (PGLYRP4) (NM_020393) Human Mass Spec Standard

CAT#: PH324039

PGLYRP4 MS Standard C13 and N15-labeled recombinant protein (NP_065126)

Product Images

Coomassie blue staining of purified PGLYRP4 protein (Cat# TP324039). The protein was produced from HEK293T cells transfected with PGLYRP4 cDNA clone (Cat# RC224039) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224039
• Predicted MW: 38.7 kDa
• Protein Sequence:
  Sequence Link

  >RC224039 representing NM_020393
  Red=Cloning site Green=Tags(s)
  
  MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSI
  QLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQGVHT
  QGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLLGKGENCLAPRQKTSLKKAC
  PGVVPRSVWGARETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQ
  DGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSD
  VARTLSPGQALYNIISTWPHFKH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065126
• RefSeq Size: 1853
• RefSeq ORF: 1119
• Synonyms: PGLYRPIbeta; PGRP-Ibeta; PGRPIB; SBBI67
• Locus ID: 57115
• UniProt ID: Q96LB8
• Cytogenetics: 1q21.3
• Summary: Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This antimicrobial protein binds to murein peptidoglycans of Gram-positive bacteria. [provided by RefSeq, Oct 2014]
• Protein Families: Druggable Genome