OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGRP1B (PGLYRP4) (NM_020393) Human Mass Spec Standard

Be the first to review this product
SKU
PH324039
PGLYRP4 MS Standard C13 and N15-labeled recombinant protein (NP_065126)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333739 Rabbit Polyclonal Anti-PGLYRP4 Antibody
100 ul
$585.00
LY412496 Transient overexpression lysate of peptidoglycan recognition protein 4 (PGLYRP4) (as WB positive control) 100 ug
$436.00

Other products for "PGRP1B or NM_020393"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224039
Predicted MW 38.7 kDa
Protein Sequence
Protein Sequence
>RC224039 representing NM_020393
Red=Cloning site Green=Tags(s)

MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSI
QLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQGVHT
QGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLLGKGENCLAPRQKTSLKKAC
PGVVPRSVWGARETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQ
DGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSD
VARTLSPGQALYNIISTWPHFKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065126
RefSeq Size 1853
RefSeq ORF 1119
Synonyms PGLYRPIbeta; PGRP-Ibeta; PGRPIB; SBBI67
Locus ID 57115
UniProt ID Q96LB8
Cytogenetics 1q21.3
Summary Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This antimicrobial protein binds to murein peptidoglycans of Gram-positive bacteria. provided by RefSeq, Oct 2014
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PGRP1B" proteins (4)
SKU Description Size Price
LC412496 Lyophilized PGLYRP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412496 Transient overexpression lysate of peptidoglycan recognition protein 4 (PGLYRP4) (as WB positive control) 100 ug
$436.00
TP324039 Purified recombinant protein of Homo sapiens peptidoglycan recognition protein 4 (PGLYRP4), 20 µg 20 ug
$867.00
TP701070 Purified recombinant protein of Human peptidoglycan recognition protein 4 (PGLYRP4), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products