OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERPINB8 (NM_002640) Human Mass Spec Standard

Be the first to review this product
SKU
PH323880
SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_002631)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810530 SERPINB8 mouse monoclonal antibody,clone OTI8F10 100 ul
$447.00
LY404778 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SERPINB8 or NM_002640"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223880
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC223880 representing NM_002640
Red=Cloning site Green=Tags(s)

MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF
QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT
EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE
VHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLE
PFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCAD
HPFLFFIRRHKTNCILFCGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002631
RefSeq Size 3390
RefSeq ORF 1122
Synonyms C18orf53; CAP2; PI-8; PI8; PSS5
Locus ID 5271
UniProt ID P50452
Cytogenetics 18q22.1
Summary The protein encoded by this gene is a member of the ov-serpin family of serine protease inhibitors. The encoded protein is produced by platelets and can bind to and inhibit the function of furin, a serine protease involved in platelet functions. In addition, this protein has been found to enhance the mechanical stability of cell-cell adhesion in the skin, and defects in this gene have been associated with an autosomal-recessive form of exfoliative ichthyosis. provided by RefSeq, Jan 2017
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERPINB8" proteins (9)
SKU Description Size Price
PH305135 SERPINB8 MS Standard C13 and N15-labeled recombinant protein (NP_001027018) 10 ug
$3,360.00
LC404778 Lyophilized SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419193 Lyophilized SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422205 Lyophilized SERPINB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404778 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419193 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422205 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305135 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3, 20 µg 20 ug
$867.00
TP323880 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products