OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRR20A (NM_198441) Human Mass Spec Standard

Be the first to review this product
SKU
PH323756
PRR20A MS Standard C13 and N15-labeled recombinant protein (NP_940843)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359108 PRR20A Antibody - N-terminal region
100 ul
$585.00
LY404930 Transient overexpression lysate of proline rich 20A (PRR20A) (as WB positive control) 100 ug
$436.00

Other products for "PRR20A or NM_198441"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223756
Predicted MW 23.3 kDa
Protein Sequence
Protein Sequence
>RC223756 protein sequence
Red=Cloning site Green=Tags(s)

MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPP
PAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSE
TGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQ
GVPVFLTDIAY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940843
RefSeq Size 1847
RefSeq ORF 663
Synonyms PRR20; PRR20B; PRR20C; PRR20D; PRR20E
Locus ID 122183
UniProt ID P86496
Cytogenetics 13q21.1
Summary This gene is one of five identical loci in a cluster on chromosome 13q21.1. The predicted protein is proline-rich and contains several dopamine D4 receptor signatures and PRINTS domains. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRR20A" proteins (3)
SKU Description Size Price
LC404930 Lyophilized PRR20A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404930 Transient overexpression lysate of proline rich 20A (PRR20A) (as WB positive control) 100 ug
$436.00
TP323756 Recombinant protein of human proline rich 20 (PRR20), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products