OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPR 150 (GPR150) (NM_199243) Human Mass Spec Standard

Be the first to review this product
SKU
PH323227
GPR150 MS Standard C13 and N15-labeled recombinant protein (NP_954713)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316325 Rabbit polyclonal anti-GPR150 antibody
100 ul
$380.00
LY403711 Transient overexpression lysate of G protein-coupled receptor 150 (GPR150) (as WB positive control) 100 ug
$665.00

Other products for "GPR 150 or NM_199243"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223227
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC223227 representing NM_199243
Red=Cloning site Green=Tags(s)

MEDLFSPSILPPAPNISVPILLGWGLNLTLGQGAPASGPPSRRVRLVFLGVILVVAVAGNTTVLCRLCGG
GGPWAGPKRRKMDFLLVQLALADLYACGGTALSQLAWELLGEPRAATGDLACRFLQLLQASGRGASAHLV
VLIALERRRAVRLPHGRPLPARALAALGWLLALLLALPPAFVVRGDSPSPLPPPPPPTSLQPGAPPAARA
WPGERRCHGIFAPLPRWHLQVYAFYEAVAGFVAPVTVLGVACGHLLSVWWRHRPQAPAAAAPWSASPGRA
PAPSALPRAKVQSLKMSLLLALLFVGCELPYFAARLAAAWSSGPAGDWEGEGLSAALRVVAMANSALNPF
VYLFFQAGDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPP
PRPRPLPCSCESAF

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_954713
RefSeq Size 1305
RefSeq ORF 1302
Synonyms PGR11
Locus ID 285601
UniProt ID Q8NGU9
Cytogenetics 5q15
Summary This gene encodes an orphan member of the class A rhodopsin-like family of G-protein-coupled receptors (GPCRs). Within the rhodopsin-like family, this gene is a member of the vasopressin-like subfamily that also includes vasopressin and oxytocin receptors. The silencing of this gene, due to promoter methylation, is associated with ovarian cancer progression. All GPCRs have a transmembrane domain that includes seven transmembrane alpha-helices. A general feature of GPCR signaling is the agonist-induced conformational change in the receptor, leading to activation of the heterotrimeric G protein. The activated G protein then binds to and activates numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. provided by RefSeq, Jul 2017
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GPR 150" proteins (3)
SKU Description Size Price
LC403711 Lyophilized GPR150 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403711 Transient overexpression lysate of G protein-coupled receptor 150 (GPR150) (as WB positive control) 100 ug
$665.00
TP323227 Recombinant protein of human G protein-coupled receptor 150 (GPR150), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products