OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TTC39B (NM_152574) Human Mass Spec Standard

Be the first to review this product
SKU
PH323149
TTC39B MS Standard C13 and N15-labeled recombinant protein (NP_689787)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358243 TTC39B Antibody - C-terminal region
100 ul
$585.00
LY433421 Transient overexpression lysate of tetratricopeptide repeat domain 39B (TTC39B), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "TTC39B or NM_152574"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223149
Predicted MW 76.8 kDa
Protein Sequence
Protein Sequence
>RC223149 representing NM_152574
Red=Cloning site Green=Tags(s)

MALLGSRAELEADEDVFEDALETISISSHSDMATSSLHFASCDTQQAPRQRGASTVSSSSSTKVDLKSGL
EECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQTCQKY
RKKYTVVESFSSLLSRGSLEQLSEEEMHAEICYAECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYKE
CLSILHEIQKNKLQQEFFYEFEGGVKLGSGAFNLMLSLLPARIIRLLEFIGFSGNRELGLLQLREGASGR
SMRSALCCLTILAFHTYISLILGTGEVNVAEAERLLAPFLQQFPNGSLVLFYHARIELLKGNLEEAQEVF
QKCISVQEEWKQFHHLCYWELMWINVFQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLPEEDVVA
TNENVVTLFRQVDSLKQRIAGKSIPTEKFAVRKARRYSASLPAPVKLILPALEMMYVWNGFSIVSKRKDL
SENLLVTVEKAEAALQSQNFNSFSVDDECLVKLLKGCCLKNLQRPLQAELCYNHVVESEKLLKYDHYLVP
FTLFELASLYKSQGEIDKAIKFLETARNNYKDYSLESRLHFRIQAALHLWRKPSSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689787
RefSeq Size 2428
RefSeq ORF 1848
Synonyms C9orf52
Locus ID 158219
UniProt ID Q5VTQ0
Cytogenetics 9p22.3
Summary Regulates high density lipoprotein (HDL) cholesterol metabolism by promoting the ubiquitination and degradation of the oxysterols receptors LXR (NR1H2 and NR1H3).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TTC39B" proteins (6)
SKU Description Size Price
LC407444 Lyophilized TTC39B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433421 Lyophilized TTC39B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407444 Transient overexpression lysate of tetratricopeptide repeat domain 39B (TTC39B), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY433421 Transient overexpression lysate of tetratricopeptide repeat domain 39B (TTC39B), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP323149 Recombinant protein of human tetratricopeptide repeat domain 39B (TTC39B), 20 µg 20 ug
$867.00
TP330421 Recombinant protein of human tetratricopeptide repeat domain 39B (TTC39B), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products