OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Glucokinase (GCK) (NM_033507) Human Mass Spec Standard

Be the first to review this product
SKU
PH322793
GCK MS Standard C13 and N15-labeled recombinant protein (NP_277042)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500459 GCK mouse monoclonal antibody, clone OTI3E3 (formerly 3E3) 100 ul
$447.00
LY400059 Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Glucokinase or NM_033507"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222793
Predicted MW 52 kDa
Protein Sequence
Protein Sequence
>RC222793 representing NM_033507
Red=Cloning site Green=Tags(s)

MAMDVTRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGS
EVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQM
KHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVAT
MISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDE
SSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIY
NILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_277042
RefSeq Size 2442
RefSeq ORF 1398
Synonyms FGQTL3; GK; GLK; HHF3; HK4; HKIV; HXKP; LGLK; MODY2; PNDM1
Locus ID 2645
UniProt ID P35557
Cytogenetics 7p13
Summary This gene encodes a member of the hexokinase family of proteins. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. The use of multiple promoters and alternative splicing of this gene result in distinct protein isoforms that exhibit tissue-specific expression in the pancreas and liver. In the pancreas, this enzyme plays a role in glucose-stimulated insulin secretion, while in the liver, this enzyme is important in glucose uptake and conversion to glycogen. Mutations in this gene that alter enzyme activity have been associated with multiple types of diabetes and hyperinsulinemic hypoglycemia. provided by RefSeq, Aug 2017
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Maturity onset diabetes of the young, Metabolic pathways, Starch and sucrose metabolism, Type II diabetes mellitus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Glucokinase" proteins (11)
SKU Description Size Price
PH300472 GCK MS Standard C13 and N15-labeled recombinant protein (NP_000153) 10 ug
$3,360.00
PH318920 GCK MS Standard C13 and N15-labeled recombinant protein (NP_277043) 10 ug
$3,360.00
LC400059 Lyophilized GCK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403250 Lyophilized GCK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409539 Lyophilized GCK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400059 Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403250 Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY409539 Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP300472 Recombinant protein of human glucokinase (hexokinase 4) (GCK), transcript variant 1, 20 µg 20 ug
$867.00
TP318920 Recombinant protein of human glucokinase (hexokinase 4) (GCK), transcript variant 3, 20 µg 20 ug
$867.00
TP322793 Recombinant protein of human glucokinase (hexokinase 4) (GCK), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products