OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CBWD1 (NM_018491) Human Mass Spec Standard

Be the first to review this product
SKU
PH322790
CBWD1 MS Standard C13 and N15-labeled recombinant protein (NP_060961)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402692 Transient overexpression lysate of COBW domain containing 1 (CBWD1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CBWD1 or NM_018491"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222790
Predicted MW 43.9 kDa
Protein Sequence
Protein Sequence
>RC222790 representing NM_018491
Red=Cloning site Green=Tags(s)

MLPAVGSADEEEDPAEEDCPELVPIETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLNYILTEQHSKR
VAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGL
ADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLVPE
EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFE
VPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDD
TERTNRLVLLGRNLDKDILKQLFIATVTETEKQWTTRFQEDQVCT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060961
RefSeq Size 1680
RefSeq ORF 1185
Synonyms COBP
Locus ID 55871
UniProt ID Q9BRT8
Cytogenetics 9p24.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CBWD1" proteins (7)
SKU Description Size Price
LC402692 Lyophilized CBWD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428840 Lyophilized CBWD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428841 Lyophilized CBWD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402692 Transient overexpression lysate of COBW domain containing 1 (CBWD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428840 Transient overexpression lysate of COBW domain containing 1 (CBWD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428841 Transient overexpression lysate of COBW domain containing 1 (CBWD1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP322790 Recombinant protein of human COBW domain containing 1 (CBWD1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products