OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHTF8 (NM_001039690) Human Mass Spec Standard

Be the first to review this product
SKU
PH322566
CHTF8 MS Standard C13 and N15-labeled recombinant protein (NP_001034779)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY421694 Transient overexpression lysate of CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "CHTF8 or NM_001039690"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222566
Predicted MW 13.3 kDa
Protein Sequence
Protein Sequence
>RC222566 protein sequence
Red=Cloning site Green=Tags(s)

MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPF
AVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034779
RefSeq Size 2934
RefSeq ORF 363
Synonyms CTF8; DERPC
Locus ID 54921
UniProt ID P0CG13
Cytogenetics 16q22.1
Summary This gene encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternatively spliced transcript variants have been described. This gene has a pseudogene on chromosome X. provided by RefSeq, Oct 2018
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHTF8" proteins (7)
SKU Description Size Price
PH322808 CHTF8 MS Standard C13 and N15-labeled recombinant protein (NP_001035236) 10 ug
$3,360.00
LC421694 Lyophilized CHTF8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421889 Lyophilized CHTF8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421694 Transient overexpression lysate of CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY421889 Transient overexpression lysate of CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP322566 Recombinant protein of human CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 1, 20 µg 20 ug
$867.00
TP322808 Recombinant protein of human CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products