OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

D4S234E (NSG1) (NM_014392) Human Mass Spec Standard

Be the first to review this product
SKU
PH322554
D4S234E MS Standard C13 and N15-labeled recombinant protein (NP_055207)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315360 Rabbit polyclonal anti-NSG1 antibody
100 ul
$380.00
LY415315 Transient overexpression lysate of DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "D4S234E or NM_014392"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222554
Predicted MW 20.7 kDa
Protein Sequence
Protein Sequence
>RC222554 representing NM_014392
Red=Cloning site Green=Tags(s)

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFT
VSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAR
EKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055207
RefSeq Size 1517
RefSeq ORF 555
Synonyms D4S234; D4S234E; NEEP21; P21
Locus ID 27065
UniProt ID P42857
Cytogenetics 4p16.3
Summary Plays a role in the recycling mechanism in neurons of multiple receptors, including AMPAR, APP and L1CAM and acts at the level of early endosomes to promote sorting of receptors toward a recycling pathway. Regulates sorting and recycling of GRIA2 through interaction with GRIP1 and then contributes to the regulation of synaptic transmission and plasticity by affecting the recycling and targeting of AMPA receptors to the synapse (By similarity). Is required for faithful sorting of L1CAM to axons by facilitating trafficking from somatodendritic early endosome or the recycling endosome (By similarity). In an other hand, induces apoptosis via the activation of CASP3 in response to DNA damage (PubMed:20599942, PubMed:20878061).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "D4S234E" proteins (5)
SKU Description Size Price
LC415315 Lyophilized NSG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421674 Lyophilized NSG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415315 Transient overexpression lysate of DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421674 Transient overexpression lysate of DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP322554 Recombinant protein of human DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products