OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTSF1L (NM_001008901) Human Mass Spec Standard

Be the first to review this product
SKU
PH322477
GTSF1L MS Standard C13 and N15-labeled recombinant protein (NP_001008901)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422897 Transient overexpression lysate of gametocyte specific factor 1-like (GTSF1L), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "GTSF1L or NM_001008901"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222477
Predicted MW 14 kDa
Protein Sequence
Protein Sequence
>RC222477 representing NM_001008901
Red=Cloning site Green=Tags(s)

MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVE
EEDTENPLKVSPPSSEQNDDTQQTFFPQKVVCENDTKESARETSPQKILRPGQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008901
RefSeq Size 773
RefSeq ORF 369
Synonyms C20orf65; dJ1028D15.4; FAM112A
Locus ID 149699
UniProt ID Q9H1H1
Cytogenetics 20q13.12
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GTSF1L" proteins (4)
SKU Description Size Price
LC422897 Lyophilized GTSF1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422897 Transient overexpression lysate of gametocyte specific factor 1-like (GTSF1L), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP322477 Recombinant protein of human gametocyte specific factor 1-like (GTSF1L), transcript variant 2, 20 µg 20 ug
$867.00
TP710312 Purified recombinant protein of Human gametocyte specific factor 1-like (GTSF1L), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products