OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

REEP5 (NM_005669) Human Mass Spec Standard

Be the first to review this product
SKU
PH322224
REEP5 MS Standard C13 and N15-labeled recombinant protein (NP_005660)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505149 REEP5 mouse monoclonal antibody, clone OTI4D2 (formerly 4D2) 100 ul
$447.00
LY401730 Transient overexpression lysate of receptor accessory protein 5 (REEP5) (as WB positive control) 100 ug
$436.00

Other products for "REEP5 or NM_005669"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222224
Predicted MW 21.3 kDa
Protein Sequence
Protein Sequence
>RC222224 representing NM_005669
Red=Cloning site Green=Tags(s)

MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYI
SIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRI
IRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005660
RefSeq Size 3116
RefSeq ORF 567
Synonyms C5orf18; D5S346; DP1; POB16; TB2; Yip2e; YOP1
Locus ID 7905
UniProt ID Q00765
Cytogenetics 5q22.2
Summary May promote functional cell surface expression of olfactory receptors.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "REEP5" proteins (3)
SKU Description Size Price
LC401730 Lyophilized REEP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401730 Transient overexpression lysate of receptor accessory protein 5 (REEP5) (as WB positive control) 100 ug
$436.00
TP322224 Recombinant protein of human receptor accessory protein 5 (REEP5), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products