LUZP2 (NM_001009909) Human Mass Spec Standard

CAT#: PH321983

LUZP2 MS Standard C13 and N15-labeled recombinant protein (NP_001009909)

Product Images

Coomassie blue staining of purified LUZP2 protein (Cat# TP321983). The protein was produced from HEK293T cells transfected with LUZP2 cDNA clone (Cat# RC221983) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221983
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC221983 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKFSPAHYLLPLLPALVLSTRQDYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQSLKNDEQSAK
  TDVQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVERKSKMIRDLQNENKSLKNKL
  LSGNKLCGIHAEESKKIQAQLKELRYGKKDLLFKAQQLTDLEQKLAVAKNELEKAALDRESQMKAMKETV
  QLCLTSVFRDQPPPPLSLITSNPTRMLLPPRNIASKLPDAAAKSKPQQSASGNNESSQVESTKEGNPSTT
  ACDSQDEGRPCSMKHKESPPSNATAETEPIPQKLQMPPCSECEVKKAPEKPLTSFEGMAAREEKIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001009909
• RefSeq Size: 5311
• RefSeq ORF: 1038
• Synonyms: KFSP2566; PRO6246
• Locus ID: 338645
• UniProt ID: Q86TE4
• Cytogenetics: 11p14.3
• Summary: This gene encodes a leucine zipper protein. This protein is deleted in some patients with Wilms tumor-Aniridia-Genitourinary anomalies-mental Retardation (WAGR) syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]