OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LUZP2 (NM_001009909) Human Mass Spec Standard

Be the first to review this product
SKU
PH321983
LUZP2 MS Standard C13 and N15-labeled recombinant protein (NP_001009909)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY423148 Transient overexpression lysate of leucine zipper protein 2 (LUZP2) (as WB positive control) 100 ug
$436.00

Other products for "LUZP2 or NM_001009909"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221983
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC221983 protein sequence
Red=Cloning site Green=Tags(s)

MKFSPAHYLLPLLPALVLSTRQDYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQSLKNDEQSAK
TDVQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVERKSKMIRDLQNENKSLKNKL
LSGNKLCGIHAEESKKIQAQLKELRYGKKDLLFKAQQLTDLEQKLAVAKNELEKAALDRESQMKAMKETV
QLCLTSVFRDQPPPPLSLITSNPTRMLLPPRNIASKLPDAAAKSKPQQSASGNNESSQVESTKEGNPSTT
ACDSQDEGRPCSMKHKESPPSNATAETEPIPQKLQMPPCSECEVKKAPEKPLTSFEGMAAREEKIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001009909
RefSeq Size 5311
RefSeq ORF 1038
Synonyms KFSP2566; PRO6246
Locus ID 338645
UniProt ID Q86TE4
Cytogenetics 11p14.3
Summary This gene encodes a leucine zipper protein. This protein is deleted in some patients with Wilms tumor-Aniridia-Genitourinary anomalies-mental Retardation (WAGR) syndrome. Alternate splicing results in multiple transcript variants. provided by RefSeq, Oct 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LUZP2" proteins (3)
SKU Description Size Price
LC423148 Lyophilized LUZP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423148 Transient overexpression lysate of leucine zipper protein 2 (LUZP2) (as WB positive control) 100 ug
$436.00
TP321983 Recombinant protein of human leucine zipper protein 2 (LUZP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products