OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RCC1 (NM_001269) Human Mass Spec Standard

Be the first to review this product
SKU
PH321798
RCC1 MS Standard C13 and N15-labeled recombinant protein (NP_001260)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380809 RCC1 Rabbit polyclonal Antibody
100 ul
$410.00
LY420775 Transient overexpression lysate of regulator of chromosome condensation 1 (RCC1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "RCC1 or NM_001269"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221798
Predicted MW 45 kDa
Protein Sequence
Protein Sequence
>RC221798 protein sequence
Red=Cloning site Green=Tags(s)

MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVV
QAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRV
FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPEL
FANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESC
FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV
ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ
S

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001260
RefSeq Size 2540
RefSeq ORF 1263
Synonyms CHC1; RCC1-I; SNHG3-RCC1
Locus ID 1104
UniProt ID P18754
Cytogenetics 1p35.3
Summary Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis (PubMed:1944575, PubMed:17435751, PubMed:20668449, PubMed:22215983, PubMed:11336674). Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis (PubMed:12194828, PubMed:17435751, PubMed:22215983). Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import (PubMed:22215983). Involved in the regulation of onset of chromosome condensation in the S phase (PubMed:3678831). Binds both to the nucleosomes and double-stranded DNA (PubMed:17435751, PubMed:18762580).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RCC1" proteins (9)
SKU Description Size Price
PH303556 SNHG3 MS Standard C13 and N15-labeled recombinant protein (NP_001041664) 10 ug
$3,360.00
LC420036 Lyophilized RCC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420775 Lyophilized RCC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420778 Lyophilized RCC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420036 Transient overexpression lysate of regulator of chromosome condensation 1 (RCC1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY420775 Transient overexpression lysate of regulator of chromosome condensation 1 (RCC1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY420778 Transient overexpression lysate of SNHG3-RCC1 readthrough transcript (SNHG3-RCC1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303556 Recombinant protein of human SNHG3-RCC1 readthrough transcript (SNHG3-RCC1), transcript variant 3, 20 µg 20 ug
$737.00
TP321798 Recombinant protein of human regulator of chromosome condensation 1 (RCC1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products