OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD11b (ITGAM) (NM_000632) Human Mass Spec Standard

Be the first to review this product
SKU
PH321743
ITGAM MS Standard C13 and N15-labeled recombinant protein (NP_000623)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807953 ITGAM mouse monoclonal antibody, clone OTI2D11 (formerly 2D11) 100 ul
$447.00
LY424601 Transient overexpression lysate of integrin, alpha M (complement component 3 receptor 3 subunit) (ITGAM), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "CD11b or NM_000632"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221743
Predicted MW 127.18 kDa
Protein Sequence
Protein Sequence
>RC221743 representing NM_000632
Red=Cloning site Green=Tags(s)

MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYST
GSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEA
LRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPN
PRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGV
IRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM
SQEGFSAAITSNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQ
VSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEDNRGAVYLFHGTSG
SGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQGHVLLLRSQPVLRVKAIMEFNPRE
VARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRR
QTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNC
GNDNICQDDLSITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKANVTSENNMPRT
NKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVRLNQT
VIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGN
LSFDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLL
ALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000623
RefSeq Size 4740
RefSeq ORF 3456
Synonyms CD11B; CR3A; MAC-1; MAC1A; MO1A; SLEB6
Locus ID 3684
UniProt ID P11215
Cytogenetics 16p11.2
Summary This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Mar 2009
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Hematopoietic cell lineage, Leukocyte transendothelial migration, Regulation of actin cytoskeleton
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD11b" proteins (3)
SKU Description Size Price
LC424601 Lyophilized ITGAM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424601 Transient overexpression lysate of integrin, alpha M (complement component 3 receptor 3 subunit) (ITGAM), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP321743 Recombinant protein of human integrin, alpha M (complement component 3 receptor 3 subunit) (ITGAM), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

Combined protein- and nucleic acid-level effects of rs1143679 (R77H), a lupus-predisposing variant within ITGAM
Maiti, Kim-Howard, Motghare et al
Hum. Mol. Genet. (2014)
Cited by 35
AI Summary: OriGene Technologies provided the full-length ITGAM cDNA (containing the rs1143679 ‘G’ allele) used in this study to investigate the genetic and molecular effects of the lupus-associated variant.
Snippet: Full-length cDNA of ITGAM (containing the rs1143679 ‘G’ allele) was obtained from Origene Technologies, Rockville, MD, USA (10) in pBR322. ITGAM cDNA was PCR amplified (forward primer-attctgacgcgtatgctctcagagtccttctg and reverse primer-ttgtaaatatcgatactggggttcggccc, amplicon size 3470 bp) and cloned into the MluI-ClaI multiple cloning site (MCS1) of the pVITRO2-neo-MCS dual expression vector (Invivogen, USA) for expression in mammalian cells. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products