OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

alpha 1 Antitrypsin (SERPINA1) (NM_001002236) Human Mass Spec Standard

Be the first to review this product
SKU
PH321489
SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001002236)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500374 Anti-SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1) 100 ul
$447.00
LY424179 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "alpha 1 Antitrypsin or NM_001002236"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221489
Predicted MW 46.7 kDa
Protein Sequence
Protein Sequence
>RC221489 protein sequence
Red=Cloning site Green=Tags(s)

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN
STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN
GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN
YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD
EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002236
RefSeq Size 3513
RefSeq ORF 1254
Synonyms A1A; A1AT; AAT; alpha1AT; nNIF; PI; PI1; PRO2275
Locus ID 5265
UniProt ID P01009
Cytogenetics 14q32.13
Summary The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Aug 2020
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Complement and coagulation cascades
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "alpha 1 Antitrypsin" proteins (41)
SKU Description Size Price
PH302082 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_000286) 10 ug
$3,360.00
PH325656 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121173) 10 ug
$3,360.00
PH325657 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121174) 10 ug
$3,360.00
PH325658 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121175) 10 ug
$3,360.00
PH325659 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121176) 10 ug
$3,360.00
PH325661 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121177) 10 ug
$3,360.00
PH325663 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121178) 10 ug
$3,360.00
PH325664 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121179) 10 ug
$3,360.00
PH325668 SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121172) 10 ug
$3,360.00
LC400112 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424179 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426858 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426859 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426860 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426861 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426862 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426863 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426864 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426865 Lyophilized SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400112 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424179 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY426858 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY426859 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY426860 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY426861 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY426862 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8 (as WB positive control) 100 ug
$436.00
LY426863 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9 (as WB positive control) 100 ug
$436.00
LY426864 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10 (as WB positive control) 100 ug
$436.00
LY426865 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11 (as WB positive control) 100 ug
$436.00
TP302082 Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1, 20 µg 20 ug
$867.00
TP321489 Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2, 20 µg 20 ug
$737.00
TP325656 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5, 20 µg 20 ug
$737.00
TP325657 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6, 20 µg 20 ug
$737.00
TP325658 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7, 20 µg 20 ug
$737.00
TP325659 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8, 20 µg 20 ug
$737.00
TP325661 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9, 20 µg 20 ug
$737.00
TP325663 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10, 20 µg 20 ug
$737.00
TP325664 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11, 20 µg 20 ug
$737.00
TP325668 Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4, 20 µg 20 ug
$737.00
TP701025 Purified protein of human z-type alpha-1-antitrypsin protein Glu342Lys mutant, Tag Free, secretory expressed in HEK cells, 50ug 50 ug
$900.00
TP760123 Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products