OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VOPP1 (NM_030796) Human Mass Spec Standard

Be the first to review this product
SKU
PH321464
VOPP1 MS Standard C13 and N15-labeled recombinant protein (NP_110423)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403081 Transient overexpression lysate of vesicular, overexpressed in cancer, prosurvival protein 1 (VOPP1) (as WB positive control) 100 ug
$436.00

Other products for "VOPP1 or NM_030796"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221464
Predicted MW 19 kDa
Protein Sequence
Protein Sequence
>RC221464 representing NM_030796
Red=Cloning site Green=Tags(s)

MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMG
VLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQV
PPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110423
RefSeq Size 2890
RefSeq ORF 516
Synonyms ECOP; GASP; WBP1L2
Locus ID 81552
UniProt ID Q96AW1
Cytogenetics 7p11.2
Summary Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VOPP1" proteins (3)
SKU Description Size Price
LC403081 Lyophilized VOPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403081 Transient overexpression lysate of vesicular, overexpressed in cancer, prosurvival protein 1 (VOPP1) (as WB positive control) 100 ug
$436.00
TP321464 Recombinant protein of human EGFR-coamplified and overexpressed protein (ECOP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products