OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RUNDC3B (NM_138290) Human Mass Spec Standard

Be the first to review this product
SKU
PH321157
RUNDC3B MS Standard C13 and N15-labeled recombinant protein (NP_612147)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340283 Rabbit Polyclonal Anti-RUNDC3B Antibody
100 ul
$585.00
LY427421 Transient overexpression lysate of RUN domain containing 3B (RUNDC3B), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RUNDC3B or NM_138290"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221157
Predicted MW 52.6 kDa
Protein Sequence
Protein Sequence
>RC221157 representing NM_138290
Red=Cloning site Green=Tags(s)

MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFNNFAAIL
EQILSHRLKEISQSCRWLAHLQIPLQGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRA
KGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFSFCLKGEGLDG
SFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTL
EQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQEL
TAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTL
NVMSEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612147
RefSeq Size 2241
RefSeq ORF 1419
Synonyms RPIB9; RPIP9
Locus ID 154661
UniProt ID Q96NL0
Cytogenetics 7q21.12
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RUNDC3B" proteins (5)
SKU Description Size Price
LC408711 Lyophilized RUNDC3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427421 Lyophilized RUNDC3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408711 Transient overexpression lysate of RUN domain containing 3B (RUNDC3B), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY427421 Transient overexpression lysate of RUN domain containing 3B (RUNDC3B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP321157 Recombinant protein of human RUN domain containing 3B (RUNDC3B), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products