OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAMD13 (NM_001010971) Human Mass Spec Standard

Be the first to review this product
SKU
PH320928
SAMD13 MS Standard C13 and N15-labeled recombinant protein (NP_001010971)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY423246 Transient overexpression lysate of sterile alpha motif domain containing 13 (SAMD13), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SAMD13 or NM_001010971"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220928
Predicted MW 12.8 kDa
Protein Sequence
Protein Sequence
>RC220928 representing NM_001010971
Red=Cloning site Green=Tags(s)

MRGVAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTVGFEEQASAFQEQE
IDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001010971
RefSeq Size 1566
RefSeq ORF 348
Synonyms HSD-41; HSD-42
Locus ID 148418
UniProt ID Q5VXD3
Cytogenetics 1p31.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAMD13" proteins (3)
SKU Description Size Price
LC423246 Lyophilized SAMD13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423246 Transient overexpression lysate of sterile alpha motif domain containing 13 (SAMD13), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP320928 Recombinant protein of human sterile alpha motif domain containing 13 (SAMD13), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products