OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTPBP9 (OLA1) (NM_013341) Human Mass Spec Standard

Be the first to review this product
SKU
PH320834
OLA1 MS Standard C13 and N15-labeled recombinant protein (NP_037473)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379457 OLA1 Rabbit polyclonal Antibody
100 ul
$410.00
LY402245 Transient overexpression lysate of Obg-like ATPase 1 (OLA1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GTPBP9 or NM_013341"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220834
Predicted MW 44.6 kDa
Protein Sequence
Protein Sequence
>RC220834 representing NM_013341
Red=Cloning site Green=Tags(s)

MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDER
FDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVD
PIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKE
IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQ
KYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKY
EDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037473
RefSeq Size 4356
RefSeq ORF 1188
Synonyms DOC45; GBP45; GTBP9; GTPBP9; PTD004
Locus ID 29789
UniProt ID Q9NTK5
Cytogenetics 2q31.1
Summary This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22. provided by RefSeq, Jun 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GTPBP9" proteins (3)
SKU Description Size Price
LC402245 Lyophilized OLA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402245 Transient overexpression lysate of Obg-like ATPase 1 (OLA1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP320834 Recombinant protein of human Obg-like ATPase 1 (OLA1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products