OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHYHIP (NM_001099335) Human Mass Spec Standard

Be the first to review this product
SKU
PH320713
PHYHIP MS Standard C13 and N15-labeled recombinant protein (NP_001092805)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334677 Rabbit Polyclonal Anti-PHYHIP Antibody
100 ul
$585.00
LY415057 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PHYHIP or NM_001099335"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220713
Predicted MW 37.6 kDa
Protein Sequence
Protein Sequence
>RC220713 protein sequence
Red=Cloning site Green=Tags(s)

MELLSTPHSIEINNITCDSFSISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPM
TVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVF
YRNHHKEYFEHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPA
QRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSMGDRFCRDRRPLLDIACNKFLTCSVEDGELVFRHAQ
DLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092805
RefSeq Size 3354
RefSeq ORF 990
Synonyms DYRK1AP3; PAHX-AP; PAHXAP1
Locus ID 9796
UniProt ID Q92561
Cytogenetics 8p21.3
Summary Its interaction with PHYH suggests a role in the development of the central system.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PHYHIP" proteins (7)
SKU Description Size Price
PH305205 PHYHIP MS Standard C13 and N15-labeled recombinant protein (NP_055574) 10 ug
$3,360.00
LC415057 Lyophilized PHYHIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420432 Lyophilized PHYHIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415057 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420432 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305205 Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2, 20 µg 20 ug
$867.00
TP320713 Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products