OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMIE (NM_147196) Human Mass Spec Standard

Be the first to review this product
SKU
PH320050
TMIE MS Standard C13 and N15-labeled recombinant protein (NP_671729)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407788 Transient overexpression lysate of transmembrane inner ear (TMIE) (as WB positive control) 100 ug
$436.00

Other products for "TMIE or NM_147196"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220050
Predicted MW 17.1 kDa
Protein Sequence
Protein Sequence
>RC220050 protein sequence
Red=Cloning site Green=Tags(s)

MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSI
IITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV
EEDEKNEAKKKKGEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_671729
RefSeq Size 1861
RefSeq ORF 465
Synonyms DFNB6
Locus ID 259236
UniProt ID Q8NEW7
Cytogenetics 3p21.31
Summary This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. provided by RefSeq, Mar 2009
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMIE" proteins (3)
SKU Description Size Price
LC407788 Lyophilized TMIE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407788 Transient overexpression lysate of transmembrane inner ear (TMIE) (as WB positive control) 100 ug
$436.00
TP320050 Recombinant protein of human transmembrane inner ear (TMIE), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products