OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATP1B2 (NM_001678) Human Mass Spec Standard

Be the first to review this product
SKU
PH320004
ATP1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001669)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349694 Rabbit Polyclonal Anti-ATP1B2 Antibody
100 ul
$205.00
LY419811 Transient overexpression lysate of ATPase, Na+/K+ transporting, beta 2 polypeptide (ATP1B2) (as WB positive control) 100 ug
$436.00

Other products for "ATP1B2 or NM_001678"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220004
Predicted MW 33.4 kDa
Protein Sequence
Protein Sequence
>RC220004 protein sequence
Red=Cloning site Green=Tags(s)

MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHT
PKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDN
GVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAEN
LGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGR
VAFKLRINKT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001669
RefSeq Size 3350
RefSeq ORF 870
Synonyms AMOG
Locus ID 482
UniProt ID P14415
Cytogenetics 17p13.1
Summary The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2014
Protein Families Transmembrane
Protein Pathways Cardiac muscle contraction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATP1B2" proteins (3)
SKU Description Size Price
LC419811 Lyophilized ATP1B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419811 Transient overexpression lysate of ATPase, Na+/K+ transporting, beta 2 polypeptide (ATP1B2) (as WB positive control) 100 ug
$436.00
TP320004 Recombinant protein of human ATPase, Na+/K+ transporting, beta 2 polypeptide (ATP1B2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products