OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LINC02872 (NM_001001709) Human Mass Spec Standard

Be the first to review this product
SKU
PH319961
C9orf170 MS Standard C13 and N15-labeled recombinant protein (NP_001001709)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334913 Rabbit Polyclonal Anti-C9orf170 Antibody
100 ul
$585.00
LY424214 Transient overexpression lysate of chromosome 9 open reading frame 170 (C9orf170) (as WB positive control) 100 ug
$436.00

Other products for "C9orf170 or NM_001001709"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219961
Predicted MW 13.4 kDa
Protein Sequence
Protein Sequence
>RC219961 protein sequence
Red=Cloning site Green=Tags(s)

MWSRRGLGVSRAPLHLLLGVWGPSGRTGGQRKGASLARPGRGGLASCSVGANGKRDVLFLRKTLTNTVED
IQIDNFRRKSDLGVGSPDWKNLLIDVTREDHENSQNNSKRRCKVNCETDQR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001709
RefSeq Size 3409
RefSeq ORF 363
Synonyms FLJ45537
Locus ID 401535
Cytogenetics 9q21.33
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C9orf170" proteins (3)
SKU Description Size Price
LC424214 Lyophilized C9orf170 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424214 Transient overexpression lysate of chromosome 9 open reading frame 170 (C9orf170) (as WB positive control) 100 ug
$436.00
TP319961 Recombinant protein of human chromosome 9 open reading frame 170 (C9orf170), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products