OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UQCRHL (NM_001089591) Human Mass Spec Standard

Be the first to review this product
SKU
PH319881
UQCRHL MS Standard C13 and N15-labeled recombinant protein (NP_001083060)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY421339 Transient overexpression lysate of ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL) (as WB positive control) 100 ug
$436.00

Other products for "UQCRHL or NM_001089591"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219881
Predicted MW 10.6 kDa
Protein Sequence
Protein Sequence
>RC219881 representing NM_001089591
Red=Cloning site Green=Tags(s)

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEE
LFDFLHAKDHCVAHKLFNNLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001083060
RefSeq Size 538
RefSeq ORF 273
Locus ID 440567
UniProt ID A0A096LP55
Cytogenetics 1p36.21
Summary This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now. provided by RefSeq, Jul 2008
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UQCRHL" proteins (3)
SKU Description Size Price
LC421339 Lyophilized UQCRHL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421339 Transient overexpression lysate of ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL) (as WB positive control) 100 ug
$436.00
TP319881 Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein-like (UQCRHL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products