OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TPD52L2 (NM_199359) Human Mass Spec Standard

Be the first to review this product
SKU
PH319692
TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_955391)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351839 Rabbit Polyclonal Anti-TPD52L2 Antibody
100 ul
$205.00
LY401134 Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 5 (as WB positive control) 100 ug
$436.00

Other products for "TPD52L2 or NM_199359"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219692
Predicted MW 19.7 kDa
Protein Sequence
Protein Sequence
>RC219692 protein sequence
Red=Cloning site Green=Tags(s)

MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK
ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRN
SATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_955391
RefSeq Size 2297
RefSeq ORF 558
Synonyms D54; TPD54
Locus ID 7165
UniProt ID Q68E05
Cytogenetics 20q13.33
Summary This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene may be a marker for breast cancer and acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 12. provided by RefSeq, Aug 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TPD52L2" proteins (9)
SKU Description Size Price
PH301547 TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_003279) 10 ug
$3,360.00
LC401134 Lyophilized TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404541 Lyophilized TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404543 Lyophilized TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401134 Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY404541 Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY404543 Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301547 Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 5, 20 µg 20 ug
$867.00
TP319692 Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 6, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products